Mrpl28 (NM_024227) Mouse Recombinant Protein

CAT#: TP518599

Purified recombinant protein of Mouse mitochondrial ribosomal protein L28 (Mrpl28), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR218599 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPLHRYPVHLWQKLRLRQGICARLPAHFLRSLEEERTPTPVHYKPHGTKFKINPKNGQRERVEDVPIPVH
  YPPESQQGLWGGEGLILGYRYANNDKLSKRVKKVWKPQLFTRELYSEILDKKFTVTVTMRTLDLIDEAYG
  FDFYILKTPKEDLGSKFGMDLKRGMLLRLARQDPHLHPENPERRAAIYDKYRSFVIPEAEAEWVGLTLEE
  ALEKQRLLEEKDPVPLFKVYVEELVQRLQEQVLSRPAVVQKRAGDHA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 30.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_077189
• Locus ID: 68611
• UniProt ID: Q9D1B9
• Cytogenetics: 17 A3.3
• Refseq Size: 1080
• Refseq ORF: 774
• Synonyms: 1110015G04Rik; L28mt; MAA; MAAT1; MRP-L28; p1; p15
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. [provided by RefSeq, Jul 2008]