Suds3 (NM_001122666) Mouse Recombinant Protein

CAT#: TP516953

Purified recombinant protein of Mouse suppressor of defective silencing 3 homolog (S. cerevisiae) (Suds3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216953 representing NM_001122666
  Red=Cloning site Green=Tags(s)
  
  MSAAGLLAPAPAPAAAPAAPEYYPEDEEELESAEDDERSCRGRESDEDTEDASETDLAKHDEEDYVEMKE
  QMYQDKLASLKRQLQQLQEGTLQEYQKRMKKLDQQYRERIRNAELFLQLETEQVERNYIKEKKAAVKEFE
  DKKVELKENLIAELEEKKKMIENEKLTMELTGDSMEVKPIMTRKLRRRPNDPVPIPDKRRKPAPAQLNYL
  LTDEQIMEDLRTLNKLKSPKRPASPSSPEHLPATPAESPAQRFEARIEDGKLYYDKRWYHKSQAIYLESK
  DNQKLSCVISSVGANEIWVRKTSDSTKMRIYVGQLQRGLFVIRRRKFLTYRD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001116138
• Locus ID: 71954
• UniProt ID: Q8BR65, A0A0R4J243
• Cytogenetics: 5 F
• Refseq Size: 2333
• Refseq ORF: 996
• Synonyms: 2400003N08Rik; 2410008L21Rik; AU067672; mSds3
• Summary: Regulatory protein which represses transcription and augments histone deacetylase activity of HDAC1. May have a potential role in tumor suppressor pathways through regulation of apoptosis. May function in the assembly and/or enzymatic activity of the mSin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes (By similarity).[UniProtKB/Swiss-Prot Function]