Tyw5 (NM_001037742) Mouse Recombinant Protein

CAT#: TP516329

Purified recombinant protein of Mouse tRNA-yW synthesizing protein 5 (Tyw5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Tyw5"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR216329 protein sequence
Red=Cloning site Green=Tags(s)

MAEQHLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVPQMDF
ISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFRE
EQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPL
FPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILD
RALKTLAELPEEYRDFYARQMVLRIQDKAYSKNFE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 36.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001032831
Locus ID 68736
UniProt ID A2RSX7
Cytogenetics 1 C1.3
Refseq Size 1448
Refseq ORF 948
Synonyms 1110034B05Rik
Summary tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes (By similarity).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.