Aldh3a1 (NM_007436) Mouse Recombinant Protein

CAT#: TP516262

Purified recombinant protein of Mouse aldehyde dehydrogenase family 3, subfamily A1 (Aldh3a1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216262 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNISSIVNRARDAFNSGKTRPLQFRVEQLEALQRMINENLKGISKALASNLRKNEWTSYYEEVAHVLDE
  IDFTIKGLSDWAEDEPVAKTRQTQEDDLYIHSEPLGVVLVIGAWNYPFNLTIQPMVGAIAAGNAVVLKPS
  EVSDHMADLLSTLIPQYMDKDLYPVIKGGVPETTELLKEKFDHIMYTGSTAVGKIVMAAAAKHLTPVTLE
  LGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNEIVEKLKKSLKDFYGEDAKQSH
  DYGRIINDRHFQRVINLIDSKKVAHGGTWDQPSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLDE
  AIKFINQREKPLALYVFSNNDKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFE
  TFSHRRSCLVRSLRNEEANKARYPPSPAKMPRH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 50.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031462
• Locus ID: 11670
• UniProt ID: P47739, Q3UNF5
• Cytogenetics: 11 37.96 cM
• Refseq Size: 1729
• Refseq ORF: 1359
• Synonyms: Ahd-4; Ahd4; Aldh; Aldh3
• Summary: ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde (Probable). They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation (Probable). Oxidizes medium and long chain aldehydes into non-toxic fatty acids (PubMed:25286108). Preferentially oxidizes aromatic aldehyde substrates (PubMed:11784860). Comprises about 50 percent of corneal epithelial soluble proteins (PubMed:11784860). May play a role in preventing corneal damage caused by ultraviolet light (PubMed:10376761).[UniProtKB/Swiss-Prot Function]