Catsperz (NM_001039494) Mouse Recombinant Protein

CAT#: TP514418

Purified recombinant protein of Mouse cation channel sperm associated auxiliary subunit zeta (Catsperz), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR214418 representing NM_001039494
  Red=Cloning site Green=Tags(s)
  
  MEESVKPVPKHANHRRSSVRSSLYGDVRDLWSTATMSTANVSVSDVCEDFDEEGKSVRNRIRKYSQTISI
  RDSLNLEPEEIQQQARRELELCHGRSLEHGEDHEESETSLASSTSESLIFSLWKPHRTYWTEQQNRLPLP
  LMELMETEVLDILKKALITYRSTIGRNHFMTKELQGYIEGIRKRRNKRLYFLDQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 22.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034583
• Locus ID: 67077
• UniProt ID: Q9CQP8
• Cytogenetics: 19 A
• Refseq Size: 781
• Refseq ORF: 582
• Synonyms: 1700019N12Rik; A430107B04Rik; MLZ-622
• Summary: Auxiliary component of the CatSper complex, a complex involved in sperm cell hyperactivation (PubMed:28226241, PubMed:31056283). Sperm cell hyperactivation is needed for sperm motility which is essential late in the preparation of sperm for fertilization (PubMed:28226241, PubMed:31056283). Required for a distribution of the CatSper complex in linear quadrilateral nanodomains along the flagellum, maximizing fertilization inside the mammalian female reproductive tract (PubMed:28226241). Together with EFCAB9, associates with the CatSper channel pore and is required for the two-row structure of each single CatSper channel (PubMed:31056283).[UniProtKB/Swiss-Prot Function]