Spata18 (NM_178387) Mouse Recombinant Protein
CAT#: TP513524
Purified recombinant protein of Mouse spermatogenesis associated 18 (Spata18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Spata18"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR213524 representing NM_178387
Red=Cloning site Green=Tags(s) MAESLKKLAKSESLQALQDKVTYWVNDYNSNSCDQNLNYCIELIEQVAKVQAQLFGILTVTAQEGGNNEG VETIKCRLLPLLQTSFSSVNMGKTAESEMCATQDFQLRSKNRDNSPDQDQHQSDNESFSETQPTQVQDDL AESGKSLEGAKNGSTISLLAAEEEINQLKKQLKSLQAQEDARHKTSENRRSEALKSDHRSTKRTQDQRPQ DVVSNYEKHLQNLKEEIAVLSAEKSGLQGRSARSPSPSTGTRSHRRGRSRSHSRSRSHSRSNSPCTTVAK IRSPSPNRAKMSSVARKAALLSRFSDAYSQARLDAQCLLRRCIDRAETVQRIIYIATVEAFHVAKMAFRH FKIRVRKMLTPSNVGSNTDFETAVSEYIVCHLDLYDSQSSVNDVIRAMNVNPKISFPPEVDFCLLTDFIQ EICCIAFAMQSLEPPLDIAFGADGEIFNDCKYRRSYDSDFTAPLVFYHVWPALMENDCVIMKGEAVTKRG AFWSSVRPVMRCRSRSLSPICPRNHFGISTVSRSRSPSPIRCTFARY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 60.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_848474 |
Locus ID | 73472 |
UniProt ID | Q0P557 |
Cytogenetics | 5 C3.3 |
Refseq Size | 1949 |
Refseq ORF | 1611 |
Synonyms | 1700067I02Rik |
Summary | Key regulator of mitochondrial quality that mediates the repairing or degradation of unhealthy mitochondria in response to mitochondrial damage. Mediator of mitochondrial protein catabolic process (also named MALM) by mediating the degradation of damaged proteins inside mitochondria by promoting the accumulation in the mitochondrial matrix of hydrolases that are characteristic of the lysosomal lumen. Also involved in mitochondrion degradation of damaged mitochondria by promoting the formation of vacuole-like structures (named MIV), which engulf and degrade unhealthy mitochondria by accumulating lysosomes. May have a role in spermatogenesis, especially in cell differentiation from late elongate spermatids to mature spermatozoa (By similarity). The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.