Smarcc2 (NM_198160) Mouse Recombinant Protein

CAT#: TP511632

Purified recombinant protein of Mouse SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 (Smarcc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR211632 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQEEVFGKHVSN
  APLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRNVEMFMTIEKSLVQNNCLSRP
  NIFLCPEIEPKLLGKLKDIVKRHQGTISEDKSNASHVVYPVPGNLEEEEWVRPVMKRDKQVLLHWGYYPD
  SYDTWIPASEIEASVEDAPTPEKPRKVHAKWILDTDTFNEWMNEEDYEVSDDKSPVSRRKKISAKTLTDE
  VNSPDSDRRDKKGGNYKKRKRSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVP
  NVEEVTLPKTVNTKKDSESAPVKGGTMTDLDEQDDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
  THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNL
  AGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSGLVPLQPKPPQQSSASQQMLN
  FPEKGKEKPADMQNFGLRTDMYTKKNVPSKSKAAASATREWTEQETLLLLEALEMYKDDWNKVSEHVGSR
  TQDECILHFLRLPIEDPYLEDSEASLGPLAYQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEF
  SKMKEEVPTALVEAHVRKVEEAAKVTGKADPAFGLESSGIAGTASDEPERIEESGTEEARPEGQAADEKK
  EPKEPREGGGAVEEEAKEEISEVPKKDEEKGKEGDSEKESEKSDGDPIVDPEKDKEPTEGQEEVLKEVAE
  PEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLEIKLRHFEELE
  TIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQQPPTLPPGSQPIPPTGAAGP
  PTVHGLAVPPAAVASAPPGSGAPPGSLGPSEQIGQAGTTAGPQQPQQAGAPQPGAVPPGVPPPGPHGPSP
  FPNQPTPPSMMPGAVPGSGHPGVADPGTPLPPDPTAPSPGTVTPVPPPQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 121.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_937803
• Locus ID: 68094
• UniProt ID: Q6PDG5
• Cytogenetics: 10 D3
• Refseq Size: 4622
• Refseq ORF: 3300
• Synonyms: 5930405J04Rik
• Summary: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Can stimulate the ATPase activity of the catalytic subunit of these complexes. May be required for CoREST dependent repression of neuronal specific gene promoters in non-neuronal cells. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (PubMed:17640523). Critical regulator of myeloid differentiation, controlling granulocytopoiesis and the expression of genes involved in neutrophil granule formation (PubMed:28369036).[UniProtKB/Swiss-Prot Function]