Mre11a (NM_018736) Mouse Recombinant Protein

CAT#: TP510160

Purified recombinant protein of Mouse MRE11A homolog A, double strand break repair nuclease (Mre11a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR210160 representing NM_018736
  Red=Cloning site Green=Tags(s)
  
  MSPTDPLDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGDLFHENKPSRK
  TLHSCLELLRKYCMGDRPVQFEVISDQSVNFGFSKFPWVNYQDGNLNISIPVFSIHGNHDDPTGADALCA
  LDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYGLGSIPDERLYRMFVNKKVTMLRPKEDENSW
  FNLFVIHQNRSKHGNTNFIPEQFLDDFIDLVIWGHEHECKIGPIKNEQQLFYVSQPGSSVVTSLSPGEAV
  KKHVGLLRIKGRKMNMQKLPLRTVRRFFIEDVVLANHPNLFNPDNPKVTQAIQSFCLEKIEEMLDSAERE
  RLGNPQQPGKPLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGKTGEEINFGMLITK
  PASEGATLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFLKERH
  IDALEDKIDEEVRRFRESRQRNTNEEDDEVREAMSRARALRSQSETSTSAFSAEDLSFDTSEQTANDSDD
  SLSAVPSRGRGRGRGRRGARGQSSAPRGGSQRGRDTGLEITTRGRSSKATSSTSRNMSIIDAFRSTRQQP
  SRNVAPKNYSETIEVDDSDEDDIFPTNSRADQRWSGTTSSKRMSQSQTAKGVDFESDEDDDDDPFMSSSC
  PRRNRR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 80.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061206
• Locus ID: 17535
• UniProt ID: Q61216, Q3TU24, Q3URU4
• Cytogenetics: 9 A2
• Refseq Size: 3034
• Refseq ORF: 2118
• Synonyms: Mre11; Mre11b
• Summary: Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11 to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.[UniProtKB/Swiss-Prot Function]