Klhl22 (NM_145479) Mouse Recombinant Protein

CAT#: TP509634

Purified recombinant protein of Mouse kelch-like 22 (Klhl22), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209634 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEEQDFAQLCRLPTQPSHSHCVNNTYRSTQHSQALLRGLLALRDSGILFDVVLVVEGKHIEAHRILLAA
  SCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNVQETLVAACQLQIPEIIHFCC
  DFLMSWVDEENILDVYRLADLFDLNHLTQQLDTYILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCE
  TEVYEGALLYHYSLEQVQADQISLNEPPKLLETVRFPLMEAEVLQRLHDKLGPSPLRDTVASALMYHRNE
  ILQPSLQGPQTELRSDFQCVVGFGGIHSTPSTILSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNF
  VYLIGGDNNVQGFRAESRCWRYDPRHNRWFQIQSLQQEHADLCVCVVGKYIYAVAGRDYHNDLSAVERYD
  PATNSWDYVAPLKKEVYAHAGTTLQGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGPVRRAWHGMAA
  LLDKLFVIGGSNNDAGYRRDVHQVACYSCTSRQWSSVCPLPAGHGEPGIAVLDSRIYVLGGRSHNRGSRT
  GYVHIYDMEKDCWEEGPQLNNSISGLAACVLTLPRSLLHEQPRGTPNRSQADADFASEVMSVSDWEEFDN
  SSED
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 71.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663454
• Locus ID: 224023
• UniProt ID: Q99JN2
• Cytogenetics: 16 11.01 cM
• Refseq Size: 2633
• Refseq ORF: 1905
• Synonyms: 2610318I18Rik; Kelchl
• Summary: Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for chromosome alignment and localization of PLK1 at kinetochores. The BCR(KLHL22) ubiquitin ligase complex mediates monoubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation. Monoubiquitination of PLK1 does not lead to PLK1 degradation (By similarity). The BCR(KLHL22) ubiquitin ligase complex is also responsible for the amino acid-stimulated 'Lys-48' polyubiquitination and proteasomal degradation of DEPDC5. Through the degradation of DEPDC5, releases the GATOR1 complex-mediated inhibition of the TORC1 pathway. It is therefore an amino acid-dependent activator within the amino acid-sensing branch of the TORC1 pathway, indirectly regulating different cellular processes including cell growth and autophagy (PubMed:29769719).[UniProtKB/Swiss-Prot Function]