OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Klhl22 (NM_145479) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509634
Purified recombinant protein of Mouse kelch-like 22 (Klhl22), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Klhl22 or NM_145479"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209634 protein sequence
Red=Cloning site Green=Tags(s)

MAEEQDFAQLCRLPTQPSHSHCVNNTYRSTQHSQALLRGLLALRDSGILFDVVLVVEGKHIEAHRILLAA
SCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNVQETLVAACQLQIPEIIHFCC
DFLMSWVDEENILDVYRLADLFDLNHLTQQLDTYILKNFVAFSRTDKYRQLPLEKVYSLLSSNRLEVSCE
TEVYEGALLYHYSLEQVQADQISLNEPPKLLETVRFPLMEAEVLQRLHDKLGPSPLRDTVASALMYHRNE
ILQPSLQGPQTELRSDFQCVVGFGGIHSTPSTILSDQAKYLNPLLGEWKHFTASLAPRMSNQGIAVLNNF
VYLIGGDNNVQGFRAESRCWRYDPRHNRWFQIQSLQQEHADLCVCVVGKYIYAVAGRDYHNDLSAVERYD
PATNSWDYVAPLKKEVYAHAGTTLQGKMYITCGRRGEDYLKETHCYDPGSNTWHTLADGPVRRAWHGMAA
LLDKLFVIGGSNNDAGYRRDVHQVACYSCTSRQWSSVCPLPAGHGEPGIAVLDSRIYVLGGRSHNRGSRT
GYVHIYDMEKDCWEEGPQLNNSISGLAACVLTLPRSLLHEQPRGTPNRSQADADFASEVMSVSDWEEFDN
SSED

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 71.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_663454
Locus ID 224023
UniProt ID Q99JN2
Cytogenetics 16 11.01 cM
RefSeq Size 2633
RefSeq ORF 1902
Synonyms 2610318I18Rik; Kelchl
Summary Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complex required for chromosome alignment and localization of PLK1 at kinetochores. The BCR(KLHL22) ubiquitin ligase complex mediates monoubiquitination of PLK1, leading to PLK1 dissociation from phosphoreceptor proteins and subsequent removal from kinetochores, allowing silencing of the spindle assembly checkpoint (SAC) and chromosome segregation. Monoubiquitination of PLK1 does not lead to PLK1 degradation (By similarity). The BCR(KLHL22) ubiquitin ligase complex is also responsible for the amino acid-stimulated 'Lys-48' polyubiquitination and proteasomal degradation of DEPDC5. Through the degradation of DEPDC5, releases the GATOR1 complex-mediated inhibition of the TORC1 pathway. It is therefore an amino acid-dependent activator within the amino acid-sensing branch of the TORC1 pathway, indirectly regulating different cellular processes including cell growth and autophagy (PubMed:29769719).UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products