Spdl1 (NM_027411) Mouse Recombinant Protein

CAT#: TP509383

Purified recombinant protein of Mouse spindle apparatus coiled-coil protein 1 (Spdl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209383 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEADITNLRNKLKECEDERLKAAHYGLQLLERQTELQSQLDKCHEEMMITAEKYNQEKHALQREVELKSR
  MLDSLSCECEALKQQQKAQLEQLEVQLHRSHRQEVSDLKNKLENLKVELDEARLGEKQLKQKLDLQGELL
  AHKSEELRLLSEQRVLSSMSSELLALQTELTAAEGVKNALKEEVNELQYKQEQLECLNTSLLHQVDRLKE
  EKEEREREAVSYYNALEKARVENQDLQVQLGHALQQAADPNSKGNSLFAEVEDRRVAMERQLNLMKDKYQ
  SLKKQNAFTRDQMNKMKLQISTLLRMRGSQTEFEQQERLFAMIEQKNGEIKHLLGEINKLEKFKNLYESM
  ESRPSTSDTACVLEDSTYYSDLLQLKLDKLNKENESTKDELSIQRMKALFESQRALDIERKLFTNERHLQ
  LSESENMKLRAKLDELKLKYEPEERIEVPVLKRRREVLPLNITTPEETEETAAASATEDGVSRLPPHREE
  ESCLNSLKDNTVQWKQPASSCVQPASLSPHKNLHLDTQPKKEKKCVKLVDSPANIEVLHEQSGNTPNSPR
  LTAESKLPTEVKERIETTSKLGKGACKKSHNIIYVSSKSAPETQCSQQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 70.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081687
• Locus ID: 70385
• UniProt ID: Q923A2
• Cytogenetics: 11 A4
• Refseq Size: 2526
• Refseq ORF: 1827
• Synonyms: 1700018I02Rik; 2600001J17Rik; 2810049B11Rik; AA409762; Ccdc99
• Summary: Required for the localization of dynein and dynactin to the mitotic kintochore. Dynein is believed to control the initial lateral interaction between the kinetochore and spindle microtubules and to facilitate the subsequent formation of end-on kinetochore-microtubule attachments mediated by the NDC80 complex. Also required for correct spindle orientation. Does not appear to be required for the removal of spindle assembly checkpoint (SAC) proteins from the kinetochore upon bipolar spindle attachment. Acts as an adapter protein linking the dynein motor complex to various cargos and converts dynein from a non-processive to a highly processive motor in the presence of dynactin. Facilitates the interaction between dynein and dynactin and activates dynein processivity (the ability to move along a microtubule for a long distance without falling off the track) (By similarity).[UniProtKB/Swiss-Prot Function]