4930432K21Rik (NM_029045) Mouse Recombinant Protein

CAT#: TP509310

Purified recombinant protein of Mouse RIKEN cDNA 4930432K21 gene (4930432K21Rik), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209310 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNKKKQRNSGVGLHPSKPSKNPRLRDSHSSMMVHSHYSRESEDSSEPAPSVELGGEEPLHEAFSCPVEDT
  GAASDLAGSPKELVPLPPSQNSVGKFVPQFAKPRKTVTRKAKAWEEDLEGCTTSQETRPELGALKAASQP
  QRESLRFPPHDIRPEVQTQPDGTLSKERTISLDNRSLGNNGFEMATVQDSSSPLSDAAAEGREADSRDPQ
  ERDAQGGEAGAQHSGEPQEGEDILYTSALAPASEPTWSVAQDLSVPTYTLSSTAAAPSSTSPADASLMDT
  VITEASLDPSVLQQSAPQVAKLLGSLDEQIPDGGCIGTLLSSTPLAEETTAGREEARWEERCHGDTLASF
  TETEPEKQEPVTEAGDSGHIAQEMDPVVKTKDSGSDEQSPGDIGMLPLPAQSMNQMLVELRGLTCDQDLE
  GLSTPHTSSQLEHTCAASDPPQSTKDCHSSPGIPVHLAAPCPRDQAAWQESSAMELDFLPDSQIQDALDA
  TNMEQGFPSGSMPDLGWPVPSSQSIGGSPKAVTKPQSRSHVETWAQETYRMQDATDTVRGLVVELSGLNR
  LIMSTHRDLEAFKRRKTKSLPYLTKGLGSLPRGDQSWRDL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 64.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_083321
• Locus ID: 74666
• UniProt ID: Q6DIA7, E9QNR8, A0A0R4J144
• Cytogenetics: 8 C2
• Refseq Size: 2494
• Refseq ORF: 1803
• Summary: Meiotic recombination factor component of recombination bridges involved in meiotic double-strand break repair (PubMed:32463460, PubMed:32460033). Modulates the localization of recombinases DMC1:RAD51 to meiotic double-strand break (DSB) sites through the interaction with and stabilization of the BRCA2:HSF2BP complex during meiotic recombination (PubMed:32460033, PubMed:32463460). Indispensable for the DSB repair, homologous synapsis, and crossover formation that are needed for progression past metaphase I, is essential for spermatogenesis and male fertility (PubMed:32463460, PubMed:32460033).[UniProtKB/Swiss-Prot Function]