OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ptpn6 (NM_013545) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509258
Purified recombinant protein of Mouse protein tyrosine phosphatase, non-receptor type 6 (Ptpn6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ptpn6 or NM_013545"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209258 protein sequence
Red=Cloning site Green=Tags(s)

MVRWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSGDFYDLYGGEKFA
TLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGGQAESLLQAKGEPWTFLVRESLS
QPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTVGGSETFDSLTDLVEHFKKTGIEEASGAFVYLR
QPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNIL
PFDHSRVILQGRDSNIPGSDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMT
TREVEKGRNKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWPDH
GVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGLDCDIDIQKTIQM
VRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGNITYPPAVRSAHAKASRTSSKHK
EEVYENVHSKSKKEEKVKKQRSADKDKNKGSLKRK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 67.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_038573
Locus ID 15170
UniProt ID P29351
Cytogenetics 6 59.17 cM
RefSeq Size 2219
RefSeq ORF 1785
Synonyms 70Z-SHP; hcp; Hcph; me; Ptp1C; PTPTY-42; SH-PTP1; SHP-1
Summary Modulates signaling by tyrosine phosphorylated cell surface receptors such as KIT and the EGF receptor/EGFR. The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates. Together with MTUS1, induces UBE2V2 expression upon angiotensin II stimulation. Plays a key role in hematopoiesis.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Growth Factors, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Regulation of Microtubule Nucleation in Mouse Bone Marrow-Derived Mast Cells by Protein Tyrosine Phosphatase SHP-1
Klebanovych, Sládková, Sulimenko et al
Cells (2019) 8 (4) DOI: 10.3390/cells8040345
AI Summary: OriGene’s C-terminally Myc-DDK-tagged Ptpn6 (tv1) plasmid was used as the template to generate EGFP-tagged mouse SHP-1 constructs, enabling the study of SHP-1’s role in microtubule nucleation in mast cells.
Snippet: To prepare C-terminally enhanced green fluorescent protein (EGFP)-tagged mouse SHP-1 (gene Ptpn6;RefSeq ID: NM_013545.3), the coding sequence without a stop codon was amplified from the C- terminally Myc-DDK-tagged Ptpn6 (tv1) (OriGene Technologies View as HTML
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products