Plat (NM_008872) Mouse Recombinant Protein

CAT#: TP508868

Purified recombinant protein of Mouse plasminogen activator, tissue (Plat), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208868 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRSSRVEYCRCNS
  GLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDTRATCFEEQGITYRGTWSTAE
  SGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPDRDLKPWCYVFKAGKYTTEFCSTPACPKGKS
  EDCYVGKGVTYRGTHSLTTSQASCLPWNSIVLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMK
  DRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQAPIFVKNKRSPGERFLCGGVLISSCWV
  LSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE
  SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTNNMLC
  AGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNMKQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 63.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032898
• Locus ID: 18791
• UniProt ID: P11214
• Cytogenetics: 8 11.42 cM
• Refseq Size: 2548
• Refseq ORF: 1680
• Synonyms: AU020998; AW212668; D8Ertd2; D8Ertd2e; t; t-; tPA
• Summary: This gene encodes a key enzyme of the fibrinolytic pathway. The encoded protein undergoes proteolytic processing by plasmin to generate a heterodimeric serine protease that cleaves the proenzyme plasminogen to produce plasmin, a protease that is required to break down fibrin clots. Additionally, the encoded protein is involved in other biological processes such as synaptic plasticity, cell migration and tissue remodeling. Mice lacking the encoded protein display a reduction in long-term potentiation in hippocampus and conversely, transgenic mice overexpressing the encoded protein have increased and prolonged long-term potentiation. [provided by RefSeq, Jul 2015]