OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Plat (NM_008872) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508868
Purified recombinant protein of Mouse plasminogen activator, tissue (Plat), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Plat or NM_008872"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208868 protein sequence
Red=Cloning site Green=Tags(s)

MKRELLCVLLLCGLAFPLPDQGIHGRFRRGARSYRATCRDEPTQTTYQQHQSWLRPMLRSSRVEYCRCNS
GLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDTRATCFEEQGITYRGTWSTAE
SGAECINWNSSVLSLKPYNARRPNAIKLGLGNHNYCRNPDRDLKPWCYVFKAGKYTTEFCSTPACPKGKS
EDCYVGKGVTYRGTHSLTTSQASCLPWNSIVLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMK
DRKLTWEYCDMSPCSTCGLRQYKRPQFRIKGGLYTDITSHPWQAPIFVKNKRSPGERFLCGGVLISSCWV
LSAAHCFLERFPPNHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEEFDDDTYDNDIALLQLRSQSKQCAQE
SSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLFNKTVTNNMLC
AGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQKDVPGVYTKVTNYLDWIHDNMKQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032898
Locus ID 18791
UniProt ID P11214
Cytogenetics 8 11.42 cM
RefSeq Size 2548
RefSeq ORF 1677
Synonyms AU020998; AW212668; D8Ertd2; D8Ertd2e; t; t-; tPA
Summary This gene encodes a key enzyme of the fibrinolytic pathway. The encoded protein undergoes proteolytic processing by plasmin to generate a heterodimeric serine protease that cleaves the proenzyme plasminogen to produce plasmin, a protease that is required to break down fibrin clots. Additionally, the encoded protein is involved in other biological processes such as synaptic plasticity, cell migration and tissue remodeling. Mice lacking the encoded protein display a reduction in long-term potentiation in hippocampus and conversely, transgenic mice overexpressing the encoded protein have increased and prolonged long-term potentiation. provided by RefSeq, Jul 2015
Protein Categories Enzyme: Peptidases, Growth Factors, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products