Ugt3a2 (NM_144845) Mouse Recombinant Protein

CAT#: TP508366

Purified recombinant protein of Mouse UDP glycosyltransferases 3 family, polypeptide A2 (Ugt3a2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208366 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAHRRWLLMSFLFLEVILLEAAKILTISTLSASHYIVISRVSQVLHEGGHNVTKLLYESANIPDFRKEK
  PSYQVINWRPPEDQEKKFADLRHRLTEEITYGRSKHHTLLKIHQYFGDLCSQLLSRKDIMDFLKNENFDL
  VLLDSMDLCSLLIVEKLGKRFVSFLPFQFSYMDFGLPSAPLSYAPVYGSGLTDQMDFWGRVKNFLMFLDF
  SMKQREILSQYDSTIQEHFVEGSQPVLSDLLLKAELWFVNSDFALDFARPLFPNTVYVGGLLDKPVQPIP
  QDLENFISQFGDSGFVLVALGSIVSMIQSKEIIKEMNSAFAHLPQGVLWTCKTSHWPKDVSLAPNVKIMD
  WLPQTDLLAHPSIRLFVTHGGMNSVMEAVHHGVPMVGIPFFFDQPENMVRVEAKNLGVSIQLQTLKAESF
  ALTMKKIIEDKRYKSAAMASKIIRHSHPLTPAQRLLGWIDHILQTGGAAHLKPYAFQQPWHEQYMLDVFL
  FLLGLMLGTLWLSVKVLVAVTRYLSIATKVKEA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 59.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_659094
• Locus ID: 223337
• UniProt ID: Q8JZZ0
• Cytogenetics: 15 A1
• Refseq Size: 2196
• Refseq ORF: 1572
• Synonyms: AI313915
• Summary: UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).[UniProtKB/Swiss-Prot Function]