Gtf2h1 (NM_008186) Mouse Recombinant Protein

CAT#: TP508340

Purified recombinant protein of Mouse general transcription factor II H, polypeptide 1 (Gtf2h1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208340 representing NM_008186
  Red=Cloning site Green=Tags(s)
  
  MAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLL
  QQLLPKFKRKANKELEEKNRMLQEDPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSTSSHKQDVGIS
  AAFLADVRPQTDGCNGLRYNLTSDIIESIFRTYPAVKMKYAETVPHNMTEKEFWTRFFQSHYFHRDRLNT
  GSKDLFAECAKIDEKGLKTMVSLGVKNPMLDLTSLEDKPLDEGYGISSVPSTSNSKSIKENSNAAIIKRF
  NHHSAMVLAAGLRKQQAQNGQNGEPSSVDGNSGDTDCFQPAVKRAKLQESIEYEDLGNNNSVKTIALNLK
  KSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQVLSSSAASSTITALSPGGALMQGGTQQ
  AVNQMVPNDIQSELKHLYVAVGELLRHFWSCFPVNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYL
  STNLVSHIEEMLQTAYNKLHAWQSRRLMKKT
  
  SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 62.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032212
• Locus ID: 14884
• UniProt ID: Q9DBA9, G3X8R4, Q7TPY0
• Cytogenetics: 7 B3
• Refseq Size: 2749
• Refseq ORF: 1641
• Synonyms: 62kDa; AW743425; AW822074; BTF2 p62; C77871; p62
• Summary: Component of the general transcription and DNA repair factor IIH (TFIIH) core complex, which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. In NER, TFIIH acts by opening DNA around the lesion to allow the excision of the damaged oligonucleotide and its replacement by a new DNA fragment. In transcription, TFIIH has an essential role in transcription initiation. When the pre-initiation complex (PIC) has been established, TFIIH is required for promoter opening and promoter escape. Phosphorylation of the C-terminal tail (CTD) of the largest subunit of RNA polymerase II by the kinase module CAK controls the initiation of transcription.[UniProtKB/Swiss-Prot Function]