Hars2 (NM_080636) Mouse Recombinant Protein

CAT#: TP508134

Purified recombinant protein of Mouse histidyl-tRNA synthetase 2 (Hars2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208134 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPHLGPLRRRAWAALLGQLLRPPSTVCTRGCHSQVAKAVLTSEQLKSHQEKPNFVIKVPKGTRDLSPQQM
  VVREKILDKIISCFKRHGAKGLDTPAFELKEMLTEKYEDNFGLMYDLKDQGGELLSLRYDLTVPFARYLA
  MNKLKKMKRYQVGKVWRRESPAIAQGRYREFCQCDFDIAGEFDPMIPDAECLRIMCEILSGLQLGDFLIK
  VNDRRVVDGIFAVCGVPESKLRTICSSMDKLDKMSWEGVRHEMVAKKGLAPEVADRIGDFVQYHGGISLV
  EDLFKDPRLSQSQLALQGLGDLKLLFEYLRLFGIADKISLDLSLARGLDYYTGVIYEAVLLESPAQAGKE
  TLSVGSVAAGGRYDNLVAQFDPKGHHVPCVGLSIGVERIFYLVEQKMKMSGEKVRTTETQVFVATPQKNF
  LQERLKIIAELWDAGIKAEMLYKNNPKLLTQLHYCEKADIPLMVIIGEQERNEGVIKLRSVASREEVTIN
  RESLVAEIQKRLSES
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 57 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_542367
• Locus ID: 70791
• UniProt ID: Q99KK9
• Cytogenetics: 18 B2
• Refseq Size: 3075
• Refseq ORF: 1518
• Synonyms: 4631412B19Rik; H; Harsl; HARSR; HO; HO3
• Summary: This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of histidine to tRNA molecules. Mutations in a similar gene in human have been associated with Perrault syndrome 2 (PRLTS2). [provided by RefSeq, Mar 2015]