OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Hars2 (NM_080636) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508134
Purified recombinant protein of Mouse histidyl-tRNA synthetase 2 (Hars2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Hars2 or NM_080636"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208134 protein sequence
Red=Cloning site Green=Tags(s)

MPHLGPLRRRAWAALLGQLLRPPSTVCTRGCHSQVAKAVLTSEQLKSHQEKPNFVIKVPKGTRDLSPQQM
VVREKILDKIISCFKRHGAKGLDTPAFELKEMLTEKYEDNFGLMYDLKDQGGELLSLRYDLTVPFARYLA
MNKLKKMKRYQVGKVWRRESPAIAQGRYREFCQCDFDIAGEFDPMIPDAECLRIMCEILSGLQLGDFLIK
VNDRRVVDGIFAVCGVPESKLRTICSSMDKLDKMSWEGVRHEMVAKKGLAPEVADRIGDFVQYHGGISLV
EDLFKDPRLSQSQLALQGLGDLKLLFEYLRLFGIADKISLDLSLARGLDYYTGVIYEAVLLESPAQAGKE
TLSVGSVAAGGRYDNLVAQFDPKGHHVPCVGLSIGVERIFYLVEQKMKMSGEKVRTTETQVFVATPQKNF
LQERLKIIAELWDAGIKAEMLYKNNPKLLTQLHYCEKADIPLMVIIGEQERNEGVIKLRSVASREEVTIN
RESLVAEIQKRLSES

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 57 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542367
Locus ID 70791
UniProt ID Q99KK9
Cytogenetics 18 B2
RefSeq Size 3075
RefSeq ORF 1515
Synonyms 4631412B19Rik; H; Harsl; HARSR; HO; HO3
Summary This gene encodes a putative member of the class II family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of histidine to tRNA molecules. Mutations in a similar gene in human have been associated with Perrault syndrome 2 (PRLTS2). provided by RefSeq, Mar 2015
Protein Categories Enzyme: Ligase, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products