Fdxr (NM_007997) Mouse Recombinant Protein

CAT#: TP507920

Purified recombinant protein of Mouse ferredoxin reductase (Fdxr), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207920 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPRCWHWWRWSAWSGLRPSPSRSTPTPGFCQKFSTQEKTPQICVVGSGPAGFYTAQHLLKHHTHAHVDI
  YEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFRGNVVVGRDVSVPELREAYHAVVLSYGAED
  HQPLGIPGEELSGVVSARAFVGWYNGLPESQELAPDLSCDTAVILGQGNVALDVARILLTPPEHLEKTDI
  TEAALGALRQSRVKTVWIVGRRGPLQVAFTIKELREMIQLPGTRPILDPSDFLGLQDRIKDVPRPRRRLT
  ELLLRTATEKPGVEEAARQALASRAWGLRFFRSPQQVLPTPDGQRVAGIRLAVTSLEGVGESTRAVPTGD
  VEDLPCGLLLSSVGYKSRPIDPSVPFDPKLGIIPNTEGRVVNVPGLYCSGWVKRGPTGVITTTMTDSFLT
  SQALLEDLKAGLLPSGPRPGYVAIQALLSNRGVRPVSFSDWEKLDAEEVSRGQGTGKPREKLVDRREMLR
  LLGH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032023
• Locus ID: 14149
• UniProt ID: Q61578
• Cytogenetics: 11 E2
• Refseq Size: 1866
• Refseq ORF: 1485
• Synonyms: AR
• Summary: Serves as the first electron transfer protein in all the mitochondrial P450 systems including cholesterol side chain cleavage in all steroidogenic tissues, steroid 11-beta hydroxylation in the adrenal cortex, 25-OH-vitamin D3-24 hydroxylation in the kidney, and sterol C-27 hydroxylation in the liver.[UniProtKB/Swiss-Prot Function]