Mef2a (BC096598) Mouse Recombinant Protein

CAT#: TP507872

Purified recombinant protein of Mouse myocyte enhancer factor 2A (cDNA clone MGC:106070 IMAGE:4979487), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207872 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSSNKLFQYASTDMDKVLLKYT
  EYNEPHESRTNSDIVEALNKKEHRGCDSPDPDTSYVLTPHTEEKYKKINEEFDNMMRNHKIAPGLPPQNF
  SMSVTVPVTSPNALSYTNPGSSLVSPSLAASSTLADSSMLSPPPATLHRNVSPGAPQRPPSTGSASGMLS
  TTDLTVPNGAGNSPVGNGFVNSRASPNLIGNTGANSLGKVMPTKSPPPPGGGSLGMNSRKPDLRVVIPPS
  SKGMMPPLNAQRISSSQATQPLATPVVSVTTPSLPPQGLVYSAMPTAYNTDYSLTSADLSALQGFTSPGM
  LSLGQASAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNINIKSEPISPPRDRMTPSGFQQQQQQPQQ
  QPPPQPPQPQPRQEMGRSPVDSLSSSSSSYDGSDREDPRGDFHSPIVLGRPPNTEDRESPSVKRMRMDTW
  VT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 53 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 17258
• UniProt ID: Q60929
• Cytogenetics: 7 36.72 cM
• Refseq Size: 2469
• Refseq ORF: 1476
• Synonyms: A430079H05Rik
• Summary: Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Also involved in the activation of numerous growth factor- and stress-induced genes. Mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. Plays diverse roles in the control of cell growth, survival and apoptosis via p38 MAPK signaling in muscle-specific and/or growth factor-related transcription. In cerebellar granule neurons, phosphorylated and sumoylated MEF2A represses transcription of NUR77 promoting synaptic differentiation. Associates with chromatin to the ZNF16 promoter (By similarity).[UniProtKB/Swiss-Prot Function]