F10 (NM_007972) Mouse Recombinant Protein
CAT#: TP507705
Purified recombinant protein of Mouse coagulation factor X (F10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207705 protein sequence
Red=Cloning site Green=Tags(s) MGSPVQLSLLCVVLASLLLPGKGVFINRERANNVLARTRRANSFFEEFKKGNLERECMEEICSYEEVREI FEDDEKTKEYWTKYKDGDQCESSPCQNQGACRDGIGGYTCTCSEGFEGKNCELFVRKLCRLDNGDCDQFC REEQNSVVCSCASGYFLGNDGKSCISTAPFPCGKITTGRRKRSVALNTSDSELDLEDALLDEDFLSPTEN PIELLNLNETQPERSSDDLVRIVGGRECKDGECPWQALLVNEDNEGFCGGTILNEFYILTAAHCLHQARR FKVRVGDRNTEKEEGNEMVHEVDVVIKHNKFQRDTYDYDIAVLRLKTPITFRMNVAPACLPQKDWAESTL MTQKTGIVSGFGRTHEKGRQSNILKMLEVPYVDRNTCKLSTSFSITQNMFCAGYEAKLEDACQGDSGGPH VTRFKNTYYVTGIVSWGEGCARKGKYGIYTKVTTFLKWIDRSMKARVGPTAETPRTAGPPN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 54 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031998 |
Locus ID | 14058 |
UniProt ID | O88947, Q3TBR2 |
Cytogenetics | 8 5.73 cM |
Refseq Size | 2503 |
Refseq ORF | 1446 |
Synonyms | AI1947; Cf10; fX |
Summary | This gene encodes factor X, a component of both the intrinsic and extrinsic blood coagulation pathways. The encoded protein is a zymogen that undergoes further processing in a vitamin K-dependent manner to generate mature factor X, a heterodimer comprised of disulfide-linked heavy and light chains. The mature factor X is proteolytically activated either by factor IXa (intrinsic pathway) or factor VIIa (extrinsic pathway) to form factor Xa serine endopeptidase. Activated factor Xa catalyzes the conversion of prothrombin to thrombin. A complete lack of the encoded protein is fatal to mice. A severe deficiency of the encoded protein in mice causes age-dependent iron deposition and cardiac fibrosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400172 | F10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400172 | Transient overexpression lysate of coagulation factor X (F10) |
USD 436.00 |
|
PH308506 | F10 MS Standard C13 and N15-labeled recombinant protein (NP_000495) |
USD 3,255.00 |
|
TP308506 | Recombinant protein of human coagulation factor X (F10), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review