Kmo (NM_133809) Mouse Recombinant Protein

CAT#: TP507671

Purified recombinant protein of Mouse kynurenine 3-monooxygenase (kynurenine 3-hydroxylase) (Kmo), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
KMO Antibody - middle region
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207671 representing NM_133809
Red=Cloning site Green=Tags(s)

MASSDTQGKRVAVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVAKSARGRSINLALSYRGRQALKAIG
LEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISRENLNKDLLTAVESYANAKVHFGHKLSKCI
PEEGVLTVLGPDKVPRDVTCDLVVGCDGAYSTVRAHLMKKPRFDYTQQYIPHGYMELTIPPKNGEYAMEP
NCLHIWPRNAYMMIALPNMDKSFTCTLFMPFEEFERLPTRSDVLDFFQKNFPDAIPLMGEQALMRDFFLL
PAQPMISVKCSPFHLKSHCVLMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNNLSMCLPEFSRFRI
PDDHAISDLSMYNYIEMRAHVNSRWFLFQKLLDKFLHAIMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKK
VINRGLFVLGSLIAIGGTYLLVHHLSLRPLEFLRRPAWMGTTGYWTRSTDISLQVPWSY

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 55 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598570
Locus ID 98256
UniProt ID Q91WN4
Cytogenetics 1 H3
Refseq Size 2512
Refseq ORF 1437
Synonyms AI046660
Summary Catalyzes the hydroxylation of L-kynurenine (L-Kyn) to form 3-hydroxy-L-kynurenine (L-3OHKyn). Required for synthesis of quinolinic acid, a neurotoxic NMDA receptor antagonist and potential endogenous inhibitor of NMDA receptor signaling in axonal targeting, synaptogenesis and apoptosis during brain development. Quinolinic acid may also affect NMDA receptor signaling in pancreatic beta cells, osteoblasts, myocardial cells, and the gastrointestinal tract.[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.