Abi2 (NM_198127) Mouse Recombinant Protein
CAT#: TP507119
Purified recombinant protein of Mouse abl-interactor 2 (Abi2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Abi2"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207119 protein sequence
Red=Cloning site Green=Tags(s) MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSPDKQRALEETKAYTTQSLASVAYLINTLAN NVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKP IDYTILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVPNDYVPS PTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPSVFPGHP VQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYNQNPVSDTPPPPPPVEEPVFDESP PPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDG WYEGVMNGVTGLFPGNYVESIMHYSE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 49.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_937760 |
Locus ID | 329165 |
UniProt ID | P62484 |
Cytogenetics | 1 C2 |
Refseq Size | 5790 |
Refseq ORF | 1341 |
Synonyms | 8430425M24Rik; AI839867; C130078H13 |
Summary | Regulator of actin cytoskeleton dynamics underlying cell motility and adhesion. Functions as a component of the WAVE complex, which activates actin nucleating machinery Arp2/3 to drive lamellipodia formation (By similarity). Acts as regulator and substrate of nonreceptor tyrosine kinases ABL1 and ABL2 involved in processes linked to cell growth and differentiation. Positively regulates ABL1-mediated phosphorylation of ENAH, which is required for proper polymerization of nucleated actin filaments at the leading edge (By similarity). Contributes to the regulation of actin assembly at the tips of neuron projections. In particular, controls dendritic spine morphogenesis and may promote dendritic spine specification toward large mushroom-type spines known as repositories of memory in the brain (PubMed:15572692). In hippocampal neurons, may mediate actin-dependent BDNF-NTRK2 early endocytic trafficking that triggers dendrite outgrowth (PubMed:27605705). Participates in ocular lens morphogenesis, likely by regulating lamellipodia-driven adherens junction formation at the epithelial cell-secondary lens fiber interface (PubMed:15572692). Also required for nascent adherens junction assembly in epithelial cells (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.