Pdia6 (NM_027959) Mouse Recombinant Protein

CAT#: TP507098

Purified recombinant protein of Mouse protein disulfide isomerase associated 6 (Pdia6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207098 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRVIGMARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEW
  KKAATALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLV
  KDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAAT
  EVKEQTKGKVKLAAVDATVNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPP
  PELLEIINEDIAKKTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYEL
  ENALGIGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPTITPREPWDGK
  DGELPVEDDIDLSDVELDDLEKDEL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082235
• Locus ID: 71853
• UniProt ID: Q922R8, Q3TML0
• Cytogenetics: 12 A1.1
• Refseq Size: 2125
• Refseq ORF: 1338
• Synonyms: 1700015E05Rik; AL023058; C77895; CaBP5; P5; Txndc7
• Summary: May function as a chaperone that inhibits aggregation of misfolded proteins (PubMed:24508390). Negatively regulates the unfolded protein response (UPR) through binding to UPR sensors such as ERN1, which in turn inactivates ERN1 signaling (By similarity). May also regulate the UPR via the EIF2AK3 UPR sensor (By similarity). Plays a role in platelet aggregation and activation by agonists such as convulxin, collagen and thrombin (By similarity).[UniProtKB/Swiss-Prot Function]