Arl13b (NM_026577) Mouse Recombinant Protein
CAT#: TP506808
Purified recombinant protein of Mouse ADP-ribosylation factor-like 13B (Arl13b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Arl13b"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206808 protein sequence
Red=Cloning site Green=Tags(s) MFSLMANCCNLFKRWREPVRKVTLVMVGLDNAGKTATAKGIQGEHPEDVAPTVGFSKIDLRQGKFQVTIF DLGGGKRIRGIWKNYYAESYGVIFVVDSSDEERMEETKETMSEVLRHPRISGKPILVLANKQDKEGALGE ADVIECLSLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLYWLLHIIAKDFDALSERIQKDTTEQRA LEEQEKRERAERVRKLREEREREQTELDGTSGLAEIDSGPVLANPFQPIAAVIIENEKKQEKEKKKQTVE KDSDVGLLEHKVEPEQAAPQSEADCCLQNPDERVVDSYREALSQQLDSEDEQDQRGSESGENSKKKTKKL RMKRSQRVEPVNTDESTPKSPTPPQPPPPVGWGTPKVTRLPKLEPLGETRHNDFYGKPLPPLAVRQRPNG DAQDTIS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 48.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080853 |
Locus ID | 68146 |
UniProt ID | Q640N2, Q9CUD0 |
Cytogenetics | 16 C1.3 |
Refseq Size | 3541 |
Refseq ORF | 1284 |
Synonyms | A530097K21Rik; A930014M17Rik; Arl2l1; C530009C10Rik; hnn |
Summary | Cilium-specific protein required to control the microtubule-based, ciliary axoneme structure. May act by maintaining the association between IFT subcomplexes A and B. Binds GTP but is not able to hydrolyze it; the GTPase activity remains unclear. Required to pattern the neural tube. Involved in cerebral cortex development: required for the initial formation of a polarized radial glial scaffold, the first step in the construction of the cerebral cortex, by regulating ciliary signaling (PubMed:23817546). Regulates the migration and placement of postmitotic interneurons in the developing cerebral cortex (PubMed:23153492).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.