Arl13b (NM_026577) Mouse Recombinant Protein

CAT#: TP506808

Purified recombinant protein of Mouse ADP-ribosylation factor-like 13B (Arl13b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206808 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSLMANCCNLFKRWREPVRKVTLVMVGLDNAGKTATAKGIQGEHPEDVAPTVGFSKIDLRQGKFQVTIF
  DLGGGKRIRGIWKNYYAESYGVIFVVDSSDEERMEETKETMSEVLRHPRISGKPILVLANKQDKEGALGE
  ADVIECLSLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLYWLLHIIAKDFDALSERIQKDTTEQRA
  LEEQEKRERAERVRKLREEREREQTELDGTSGLAEIDSGPVLANPFQPIAAVIIENEKKQEKEKKKQTVE
  KDSDVGLLEHKVEPEQAAPQSEADCCLQNPDERVVDSYREALSQQLDSEDEQDQRGSESGENSKKKTKKL
  RMKRSQRVEPVNTDESTPKSPTPPQPPPPVGWGTPKVTRLPKLEPLGETRHNDFYGKPLPPLAVRQRPNG
  DAQDTIS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080853
• Locus ID: 68146
• UniProt ID: Q640N2, Q9CUD0
• Cytogenetics: 16 C1.3
• Refseq Size: 3541
• Refseq ORF: 1284
• Synonyms: A530097K21Rik; A930014M17Rik; Arl2l1; C530009C10Rik; hnn
• Summary: Cilium-specific protein required to control the microtubule-based, ciliary axoneme structure. May act by maintaining the association between IFT subcomplexes A and B. Binds GTP but is not able to hydrolyze it; the GTPase activity remains unclear. Required to pattern the neural tube. Involved in cerebral cortex development: required for the initial formation of a polarized radial glial scaffold, the first step in the construction of the cerebral cortex, by regulating ciliary signaling (PubMed:23817546). Regulates the migration and placement of postmitotic interneurons in the developing cerebral cortex (PubMed:23153492).[UniProtKB/Swiss-Prot Function]