Syt2 (NM_009307) Mouse Recombinant Protein

CAT#: TP506710

Purified recombinant protein of Mouse synaptotagmin II (Syt2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206710 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIA
  MAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEP
  ENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNET
  FTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTS
  LRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPF
  EQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGK
  NK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033333
• Locus ID: 20980
• UniProt ID: P46097, A0A0R4J2C2
• Cytogenetics: 1 58.24 cM
• Refseq Size: 3386
• Refseq ORF: 1269
• Synonyms: IP4BP; mKIAA4194; R74640; sytII
• Summary: This gene encodes a member of the synaptotagmin protein family. Synaptotagmin proteins are involved in membrane trafficking and are characterized by an N-terminal transmembrane region as well as tandem calcium binding domains. The encoded protein is able to bind inositol polyphosphate and is thought to be involved in synaptic function and neurotransmitter release. [provided by RefSeq, Sep 2017]