Rcc1 (NM_133878) Mouse Recombinant Protein

CAT#: TP506705

Purified recombinant protein of Mouse regulator of chromosome condensation 1 (Rcc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206705 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPKRIAKRRSPPEDAIPKSKKVKVSHRSHNTEPGLVLTLGQGDVGQLGLGESVLERKKPALVPLLQDVV
  QAEAGGMHTVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTEDGRV
  FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRVPEL
  FANRGGRQGLGRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSC
  FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPVVSSV
  ACGASVGYAVSKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMTGKQLENRVVLTVSSGGQHTVLLVKDQAQ
  S
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 44.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598639
• Locus ID: 100088
• UniProt ID: Q8VE37, Q3U6D2
• Cytogenetics: 4 D2.3
• Refseq Size: 2293
• Refseq ORF: 1266
• Synonyms: 4931417M11Rik; AI326872; Chc1
• Summary: Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA.[UniProtKB/Swiss-Prot Function]