Serpinf1 (NM_011340) Mouse Recombinant Protein

CAT#: TP506610

Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade F, member 1 (Serpinf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206610 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQALVLLLWTGALLGHGSSQNVPSSSEGSPVPDSTGEPVEEEDPFFKVPVNKLAAAVSNFGYDLYRLRSS
  ASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLKSASR
  IVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVA
  YFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLT
  VTQNLTMIEESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPV
  KLTQVEHRAAFEWNEEGAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSST
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 46.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_035470
• Locus ID: 20317
• UniProt ID: P97298
• Cytogenetics: 11 B5
• Refseq Size: 1497
• Refseq ORF: 1254
• Synonyms: AI195227; EPC-1; Pedf; Pedfl; Sdf3
• Summary: Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.[UniProtKB/Swiss-Prot Function]