Serpinf1 (NM_011340) Mouse Recombinant Protein
CAT#: TP506610
Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade F, member 1 (Serpinf1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Serpinf1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206610 protein sequence
Red=Cloning site Green=Tags(s) MQALVLLLWTGALLGHGSSQNVPSSSEGSPVPDSTGEPVEEEDPFFKVPVNKLAAAVSNFGYDLYRLRSS ASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITNPDIHSTYKELLASVTAPEKNLKSASR IVFERKLRVKSSFVAPLEKSYGTRPRILTGNPRVDLQEINNWVQAQMKGKIARSTREMPSALSILLLGVA YFKGQWVTKFDSRKTTLQDFHLDEDRTVRVPMMSDPKAILRYGLDSDLNCKIAQLPLTGSMSIIFFLPLT VTQNLTMIEESLTSEFIHDIDRELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITGKPV KLTQVEHRAAFEWNEEGAGSSPSPGLQPVRLTFPLDYHLNQPFLFVLRDTDTGALLFIGRILDPSST myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 46.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035470 |
Locus ID | 20317 |
UniProt ID | P97298 |
Cytogenetics | 11 B5 |
Refseq Size | 1497 |
Refseq ORF | 1254 |
Synonyms | AI195227; EPC-1; Pedf; Pedfl; Sdf3 |
Summary | Neurotrophic protein; induces extensive neuronal differentiation in retinoblastoma cells. Potent inhibitor of angiogenesis. As it does not undergo the S (stressed) to R (relaxed) conformational transition characteristic of active serpins, it exhibits no serine protease inhibitory activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP721012 | Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade F, member 1 (Serpinf1) |
USD 330.00 |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.