Pnpla3 (NM_054088) Mouse Recombinant Protein

CAT#: TP506522

Purified recombinant protein of Mouse patatin-like phospholipase domain containing 3 (Pnpla3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Pnpla3 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206522 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MYDPERRWSLSFAGCGFLGFYHVGATLCLSERAPHLLRDARTFFGCSAGALHAVTFVCSLPLGRIMEILM
  DLVRKARSRNIGTLHPFFNINKCIRDGLQESLPDNVHQVISGKVHISLTRVSDGENVLVSEFHSKDEVVD
  ALVCSCFIPLFSGLIPPSFRGERYVDGGVSDNVPVLDAKTTITVSPFYGEHDICPKVKSTNFFHVNITNL
  SLRLCTGNLQLLTRALFPSDVKVMGELCYQGYLDAFRFLEENGICNGPQRSLSLSLVAPEACLENGKLVG
  DKVPVSLCFTDENIWETLSPELSTALSEAIKDREGYLSKVCNLLPVRILSYIMLPCSLPVESAIAAVHRL
  VTWLPDIQDDIQWLQWATSQVCARMTMCLLPSTRSRASKDDHRMLKHGHHPSPHKPQGNSAGL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 45.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_473429
• Locus ID: 116939
• UniProt ID: Q91WW7, E9QNZ9
• Cytogenetics: 15 E2
• Refseq Size: 4649
• Refseq ORF: 1242
• Synonyms: Adpn
• Summary: Specifically catalyzes coenzyme A (CoA)-dependent acylation of 1-acyl-sn-glycerol 3-phosphate (2-lysophosphatidic acid/LPA) to generate phosphatidic acid (PA), an important metabolic intermediate and precursor for both triglycerides and glycerophospholipids. Does not esterify other lysophospholipids. Acyl donors are long chain (at least C16) fatty acyl-CoAs: arachidonoyl-CoA, linoleoyl-CoA, oleoyl-CoA and at a lesser extent palmitoyl-CoA (PubMed:22560221). Additionally possesses low triacylglycerol lipase and CoA-independent acylglycerol transacylase activities and thus may play a role in acyl-chain remodeling of triglycerides (By similarity).[UniProtKB/Swiss-Prot Function]