Hoxa10 (NM_008263) Mouse Recombinant Protein
CAT#: TP506267
Purified recombinant protein of Mouse homeobox A10 (Hoxa10), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Hoxa10"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206267 representing NM_008263
Red=Cloning site Green=Tags(s) MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGVGGGSAGGGGGGYYAHGGVYLPPASDL PYGLQSCGLFPALGSKRNEAPSPGGGGGGGSGGLGPGTHGYAPAPLDLWLDAPRSCRMEPPDGPPPPQPQ PQQQQQQPPPPPPQPPQPQPQATSCSFAQNIKEESSYCLYDAADKCPKGSAAADLAPFPRGPPPDGCALG ASSGVPVPGYFRLSQAYGTAKGFGSGGGGTQQLASPFPAQPPGRGFDPPPALASGSTEAAGKERVLDSTP PPTLVCTGGGGSQGDEEAHASSSAAEELSPAPSENSKASPEKDSLGSSKGENAANWLTAKSGRKKRCPYT KHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 43.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_032289 |
Locus ID | 15395 |
UniProt ID | P31310 |
Cytogenetics | 6 25.4 cM |
Refseq Size | 2581 |
Refseq ORF | 1248 |
Synonyms | Hox-1.8; Hoxa-10 |
Summary | In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. This gene is part of a cluster on chromosome 6 and encodes a DNA-binding transcription factor that may regulate gene expression, morphogenesis, and differentiation. More specifically, it may function in fertility, embryo viability, and regulation of hematopoietic lineage commitment. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.