Myg1 (NM_021713) Mouse Recombinant Protein

CAT#: TP505927

Purified recombinant protein of Mouse melanocyte proliferating gene 1 (Myg1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205927 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRRFLRGILTLPLRSVLQAQHRMLGSEQDPPAKRLRNNLMAPPRIGTHNGTFHCDEALACALLRLLPEY
  ANAEIVRTRDPEKLASCDIVVDVGGEYNPQSHRYDHHQRTFTETMSSLCPGKPWQTKLSSAGLVYLHFGR
  KLLAQLLGTSEEDSVVDTIYDKMYENFVEEVDAVDNGISQWAEGEPLYAMTTTLSARVARLNPTWNQPNQ
  DTEAGFRRAMDLVQEEFLQRLNFYQHSWLPARALVEEALAQRFKVDSSGEIVELAKGGCPWKEHLYHLES
  ELSPKVAITFVIYTDQAGQWRVQCVPKEPHSFQSRLPLPEPWRGLRDKALDQVSGIPGCIFVHASGFIGG
  HHTREGALNMARATLAQRPAPVPLANAVVQ
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068359
• Locus ID: 60315
• UniProt ID: Q9JK81
• Cytogenetics: 15 F3
• Refseq Size: 1480
• Refseq ORF: 1143
• Synonyms: 0610023A07Rik; 2810433J21Rik; 5830429P19Rik; AI325965; Gamm1
• Summary: 3'-5' RNA exonuclease which cleaves in situ on specific transcripts in both nucleus and mitochondrion. Involved in regulating spatially segregated organellar RNA processing, acts as a coordinator of nucleo-mitochondrial crosstalk (PubMed:31081026). In nucleolus, processes pre-ribosomal RNA involved in ribosome assembly and alters cytoplasmic translation. In mitochondrial matrix, processes 3'-termini of the mito-ribosomal and messenger RNAs and controls translation of mitochondrial proteins (PubMed:31081026).[UniProtKB/Swiss-Prot Function]