Rragb (NM_001004154) Mouse Recombinant Protein

CAT#: TP505810

Purified recombinant protein of Mouse Ras-related GTP binding B (Rragb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205810 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEESDSEKKTEKENVGPKVEPPLGEPEGSLGWAMPNAAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTR
  RLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRD
  NIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPEAKIFCLVHKMDLVQEDQRDLIFKEREEDLR
  RLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQC
  KEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLIN
  IRNARKHFEKLERVDGPKQCLLMR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001004154
• Locus ID: 245670
• UniProt ID: Q6NTA4
• Cytogenetics: X F3
• Refseq Size: 2308
• Refseq ORF: 1125
• Synonyms: MGC69750; MGC95567
• Summary: Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade. Forms heterodimeric Rag complexes with RRAGC or RRAGD and cycles between an inactive GDP-bound and an active GTP-bound form. In its active form participates in the relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. Involved in the RCC1/Ran-GTPase pathway.[UniProtKB/Swiss-Prot Function]