Arpc1a (NM_019767) Mouse Recombinant Protein
CAT#: TP505701
Purified recombinant protein of Mouse actin related protein 2/3 complex, subunit 1A (Arpc1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Arpc1a"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205701 protein sequence
Red=Cloning site Green=Tags(s) MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWTKAHELKEHNGHITGIDWAPKSDRIVTC GADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV SFSASGNRLAWVSHDSTVSVADASKSVQVSTLRTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL TFVSKLDVPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG AMTIWDFKTLESSIQGLRIM myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062741 |
Locus ID | 56443 |
UniProt ID | Q9R0Q6 |
Cytogenetics | 5 G2 |
Refseq Size | 1588 |
Refseq ORF | 1113 |
Synonyms | 41kDa; 0610010H08Rik; 1110030K07Rik; AA407347; Sid32; Sid329 |
Summary | Probably functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity). In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.