Dcdc2a (NM_001195617) Mouse Recombinant Protein

CAT#: TP505677

Purified recombinant protein of Mouse doublecortin domain containing 2a (Dcdc2a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205677 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGPSSRSSHLSQPVVKSVLVYRNGDPFFAGRRVVIHEKKVSSFDVFLKEVTGGVQAPFGAVRNIYTPRT
  GHRIRKLDQIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVSARFRKSLHEPCT
  IFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLRSGAVHRLYTLEGKLVESGAELENGQFYVAV
  GRDKFKRLPYSELLFDKSAMRRPYGQKASSLPPMVGSRKSKGSGNYRQSKSTIGSSDNSSPQPLKRKGKK
  DSNSEKPTKVKQSVKSKTSHQAIPDNGWLIKVERDTCLRPQLDGNRNRVTALPPYPWSIHTRHMWDAPGE
  DRWKKVTNKAQPTYGHSM
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 41.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001182546
• Locus ID: 195208
• UniProt ID: Q5DU00
• Cytogenetics: 13 A3.1
• Refseq Size: 2370
• Refseq ORF: 1107
• Synonyms: AW492955; Dcdc2; RU; RU2
• Summary: This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Sep 2010]