Sdccag3 (NM_001085408) Mouse Recombinant Protein

CAT#: TP505506

Purified recombinant protein of Mouse endosome associated trafficking regulator 1 (Entr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205506 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGYARRQGAPPLSRTRSLVVPDGDKLEDLEEANPFSFKEFLKTKNLSLSKEDTTTSRIYPKEASRHPLG
  LEHSSPASQLMGYGLESQQPFFEDPTRASNLEEDEDDGWNITYLPSAVDQTHSSRDTQDSPPCDTYLSFF
  SNSSELACPESLPPWTLSDTDSRISPASPAGSPNADFAAHEESLGDRHLRTLQISYEALKDENSKLRRKL
  NEVQSFSETQTEMVRTLERKLEAKMIKEESDFHDLESVVQQVEQNLELMTKRAVKAENHVLKLKQEINLL
  QAQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMNSAHASIKQLVSGADTLNLVAEILKSIDRI
  SEVKDEVDS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001078877
• Locus ID: 68112
• UniProt ID: A2AIW0
• Cytogenetics: 2 A3
• Refseq Size: 1976
• Refseq ORF: 1080
• Synonyms: C330016H24Rik; C630038K21Rik
• Summary: May be involved in modulation of TNF response. May be involved in presentation of TNFRSF1A on the cell surface (PubMed:16332174). Involved in the endosome-to-plasma membrane trafficking and recycling of SNX27-retromer-dependent cargo proteins, such as GLUT1. Involved in the regulation of cytokinesis; the function may involve PTPN13 and GIT1 (By similarity).[UniProtKB/Swiss-Prot Function]