Gnaq (NM_008139) Mouse Recombinant Protein

CAT#: TP505488

Purified recombinant protein of Mouse guanine nucleotide binding protein, alpha q polypeptide (Gnaq), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205488 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIHGSGYSDED
  KRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGI
  QECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRS
  ERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEE
  KIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQL
  NLKEYNLV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032165
• Locus ID: 14682
• UniProt ID: P21279, Q3UHH5
• Cytogenetics: 19 11.01 cM
• Refseq Size: 5634
• Refseq ORF: 1077
• Synonyms: 1110005L02Rik; 6230401I02Rik; AA408290; AW060788; Dsk1; Dsk10; Galphaq; Gq; GqI
• Summary: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro).[UniProtKB/Swiss-Prot Function]