Rfc2 (NM_020022) Mouse Recombinant Protein

CAT#: TP505290

Purified recombinant protein of Mouse replication factor C (activator 1) 2 (Rfc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205290 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEVQESGCDPSESGAQEPSPVPSKTAGHYELPWVEKYRPLKLNEIVGNEDTVSRLEVFAREGNVPNIIIA
  GPPGTGKTTSILCLARALLGPALKDAVLELNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADS
  MTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQVLTRLMNVIEKEKVPYTD
  DGLEAIIFTAQGDMRQALNNLQSTFSGFGYINSENVFKVCDEPHPLLVKEMIQHCVDANIDEAYKILAHL
  WHLGYSPEDVIGNIFRVCKTFPMAEYLKLEFIKEIGYTHMKVAEGVNSLLQMAGLLARLCQKTMAPVAS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 38.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064406
• Locus ID: 19718
• UniProt ID: Q9WUK4, Q4KL82
• Cytogenetics: 5 74.68 cM
• Refseq Size: 1518
• Refseq ORF: 1050
• Synonyms: 40kDa; 2610008M13Rik; AI326953; Recc2
• Summary: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1. This subunit binds ATP (By similarity).[UniProtKB/Swiss-Prot Function]