Pdlim4 (NM_019417) Mouse Recombinant Protein

CAT#: TP504849

Purified recombinant protein of Mouse PDZ and LIM domain 4 (Pdlim4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204849 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTHSVTLRGPSPWGFRLVGGRDFSAPLTISRVHAGSKAALAALCPGDLIQAINGESTELMTHLEAQNRIK
  GCHDHLTLSVSRPENKNWPSAPDDKAQAHRIHIDPESQDCSPATSRRSSVSGISLEDNRSGLGSPYGQPP
  RLPVPHNGSSNEATLPAQMSALHVSPPTSADTARVLPRNRDCRVDLGSEVYRMLREPAEPTASEPKQSGS
  FRYLQGMLEAGEGGDRPGSGGPRNLKPAASKLGAPLSGLQGLPECTRCGHGIVGTIVKARDKLYHPECFM
  CSDCGLNLKQRGYFFLDERLYCENHAKARVKPPEGYDVVAVYPNAKVELV
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 35.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062290
• Locus ID: 30794
• UniProt ID: P70271
• Cytogenetics: 11 32.13 cM
• Refseq Size: 1189
• Refseq ORF: 993
• Synonyms: Ril
• Summary: Suppresses SRC activation by recognizing and binding to active SRC and facilitating PTPN13-mediated dephosphorylation of SRC 'Tyr-419' leading to its inactivation. Inactivated SRC dissociates from this protein allowing the initiation of a new SRC inactivation cycle. Involved in reorganization of the actin cytoskeleton (By similarity). In nonmuscle cells, binds to ACTN1 (alpha-actinin-1), increases the affinity of ACTN1 to F-actin (filamentous actin), and promotes formation of actin stress fibers. Involved in regulation of the synaptic AMPA receptor transport in dendritic spines of hippocampal pyramidal neurons directing the receptors toward an insertion at the postsynaptic membrane. Links endosomal surface-internalized GRIA1-containing AMPA receptors to the alpha-actinin/actin cytoskeleton. Increases AMPA receptor-mediated excitatory postsynaptic currents in neurons (By similarity).[UniProtKB/Swiss-Prot Function]