Xrcc4 (NM_028012) Mouse Recombinant Protein

CAT#: TP504755

Purified recombinant protein of Mouse X-ray repair complementing defective repair in Chinese hamster cells 4 (Xrcc4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204755 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERKVSRIYLASEPNVPYFLQVSWERAIGSGFVITLTDGHSAWTATVSELEISQEADDMAMEKGKYIDEL
  RKALVPGSGAAGTYKFLFSKESQHFSLEKELKDVSFRLGSFNLDKVSNSAEVIRELICYCLDTITEKQAK
  NEHLQKENERLLRDWNDVQGRFEKCVSAKEALEADLYQRFILVLNEKKTKIRSLHKLLNEVQQLEESTKP
  ERENPCSDKTPEEHGLYDGSTDEESGAPVQAAETLHKDDSIFSSPDVTDIAPSRKRRHRMQKNLGTEPKM
  APQELPLQEKERLASSLPQTLKEESTSAENMSLETLRNSSPEDLFD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 37.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_082288
• Locus ID: 108138
• UniProt ID: Q924T3, A0A0R4J024
• Cytogenetics: 13 C3
• Refseq Size: 1557
• Refseq ORF: 981
• Synonyms: 2310057B22Rik; AW413319; AW545101
• Summary: Involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination. Binds to DNA and to DNA ligase IV (LIG4). The LIG4-XRCC4 complex is responsible for the NHEJ ligation step, and XRCC4 enhances the joining activity of LIG4. Binding of the LIG4-XRCC4 complex to DNA ends is dependent on the assembly of the DNA-dependent protein kinase complex DNA-PK to these DNA ends (By similarity).[UniProtKB/Swiss-Prot Function]