Akr1d1 (NM_145364) Mouse Recombinant Protein

CAT#: TP504723

Purified recombinant protein of Mouse aldo-keto reductase family 1, member D1 (Akr1d1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204723 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREK
  IAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRII
  YDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQ
  HDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIK
  ENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 37.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663339
• Locus ID: 208665
• UniProt ID: Q8VCX1
• Cytogenetics: 6 B1
• Refseq Size: 2713
• Refseq ORF: 978
• Synonyms: MGC25814
• Summary: Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta-hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3-one).[UniProtKB/Swiss-Prot Function]