Anxa13 (NM_027211) Mouse Recombinant Protein

CAT#: TP504573

Purified recombinant protein of Mouse annexin A13 (Anxa13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal anti-Anxa13 antibody
    • 100 ul

USD 539.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Anxa13"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204573 protein sequence
Red=Cloning site Green=Tags(s)

MGNRHAKERSHHHGFDADRDAKKLYKACKGMGTDEAAIIEVLSSRTSEERQQIKQKYKEKYGKDLEEVLN
SELSGNFKKTALALLDRPNEYAARQLQKAMKGVGTDEAMLIEILCTRSNKEIVAIKEAYQRLFGRSLESD
VKEDTSGNLRKILVSLLQASRDEEDTVDKELAGQDAKDLYDAGEGRWGTDELAFNEVLAKRSYKQLRATF
QAYQILIGKDMEETIEEETSGDLKKAYLTIVRCAQDLEGYFADLLYKAMKGMGTDEETLIRIIVTRAEVD
LQGIKAKFQEKYQKSLSDMVHSDTSGDFRKLLVALLH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081487
Locus ID 69787
UniProt ID Q99JG3
Cytogenetics 15 24.66 cM
Refseq Size 1408
Refseq ORF 954
Synonyms 1810034H17Rik; AV055219
Summary Binds to membranes enriched in phosphatidylserine or phosphatidylglycerol in a calcium-dependent manner. Half-maximal membrane binding requires about 60 uM calcium. Does not bind to membranes that lack phospholipids with an acidic headgroup.[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.