Lgals8 (NM_018886) Mouse Recombinant Protein
CAT#: TP504541
Purified recombinant protein of Mouse lectin, galactose binding, soluble 8 (Lgals8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Lgals8"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204541 representing NM_018886
Red=Cloning site Green=Tags(s) MLSLNNLQNIIYNPIIPYVGTITEQLKPGSLIVIRGHVPKDSERFQVDFQLGNSLKPRADVAFHFNPRFK RSSCIVCNTLTQEKWGWEEITYDMPFRKEKSFEIVFMVLKNKFQVAVNGRHVLLYAHRISPEQIDTVGIY GKVNIHSIGFRFSSDLQSMETSALGLTQINRENIQKPGKLQLSLPFEARLNASMGPGRTVVIKGEVNTNA RSFNVDLVAGKTRDIALHLNPRLNVKAFVRNSFLQDAWGEEERNITCFPFSSGMYFEMIIYCDVREFKVA INGVHSLEYKHRFKDLSSIDTLSVDGDIRLLDVRSW myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 36.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061374 |
Locus ID | 56048 |
UniProt ID | Q9JL15, Q542M5 |
Cytogenetics | 13 4.64 cM |
Refseq Size | 2810 |
Refseq ORF | 948 |
Synonyms | 1200015E08Rik; AI326142; D13Ertd524e; Lgals-8 |
Summary | Beta-galactoside-binding lectin that acts as a sensor of membrane damage caused by infection and restricts the proliferation of infecting pathogens by targeting them for autophagy. Detects membrane rupture by binding beta-galactoside ligands located on the lumenal side of the endosome membrane; these ligands becoming exposed to the cytoplasm following rupture. Restricts infection by initiating autophagy via interaction with CALCOCO2/NDP52. Required to restrict infection of bacterial invasion such as S.typhimurium. Also required to restrict infection of Picornaviridae viruses. Has a marked preference for 3'-O-sialylated and 3'-O-sulfated glycans.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.