Jam3 (NM_023277) Mouse Recombinant Protein

CAT#: TP504404

Purified recombinant protein of Mouse junction adhesion molecule 3 (Jam3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204404 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKI
  QDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPV
  TPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVH
  KDDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGE
  SYKSPGKHDGVNYIRTSEEGDFRHKSSFVI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 34.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075766
• Locus ID: 83964
• UniProt ID: Q9D8B7
• Cytogenetics: 9 A4
• Refseq Size: 1986
• Refseq ORF: 933
• Synonyms: 1110002N23Rik; JAM-3; JAM-C; Jcam3
• Summary: Mediates cell-cell adhesion. Functions as counter-receptor for JAM2 (PubMed:15372036). Functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN) (By similarity). Plays a role in angiogenesis (PubMed:15994945). May play a role in the regulation of cell migration (By similarity). Required for normal polarization and acrosome formation in developing spermatids, and for normal male fertility (PubMed:15372036).[UniProtKB/Swiss-Prot Function]