Jam3 (NM_023277) Mouse Recombinant Protein
CAT#: TP504404
Purified recombinant protein of Mouse junction adhesion molecule 3 (Jam3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Jam3"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204404 protein sequence
Red=Cloning site Green=Tags(s) MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKI QDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPV TPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVH KDDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGE SYKSPGKHDGVNYIRTSEEGDFRHKSSFVI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 34.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_075766 |
Locus ID | 83964 |
UniProt ID | Q9D8B7 |
Cytogenetics | 9 A4 |
Refseq Size | 1986 |
Refseq ORF | 933 |
Synonyms | 1110002N23Rik; JAM-3; JAM-C; Jcam3 |
Summary | Mediates cell-cell adhesion. Functions as counter-receptor for JAM2 (PubMed:15372036). Functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN) (By similarity). Plays a role in angiogenesis (PubMed:15994945). May play a role in the regulation of cell migration (By similarity). Required for normal polarization and acrosome formation in developing spermatids, and for normal male fertility (PubMed:15372036).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.