Hnrnpc (NM_001170984) Mouse Recombinant Protein

CAT#: TP504015

Purified recombinant protein of Mouse heterogeneous nuclear ribonucleoprotein C (Hnrnpc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204015 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASNVTNKTDPRSMNSRVFIGNLNTLVVKKSDVEAIFSKYGKIVGRSVHKGFAFVQYVNERNARAAVAGE
  DGRMIAGQVLDINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARVPPPPPIARAV
  VPSKRQRVSGNTSRRGKSGFNSKSGQRGSSSKSGKLKGDDLQAIKKELTQIKQKVDSLLESLEKIEKEQS
  KQAEMKNEKSEEEQSSASVKKDETNVKMESEAGADDSAEEGDLLDDDDNEDRGDDQLELKDDEKEPEEGE
  DDRDSANGEDDS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001164455
• Locus ID: 15381
• UniProt ID: Q9Z204
• Cytogenetics: 14 26.79 cM
• Refseq Size: 2781
• Refseq ORF: 879
• Synonyms: AL022939; D14Wsu171e; hnrnp-C; hnRNPC1; hnRNPC2; Hnrpc; Hnrpc1; Hnrpc2
• Summary: Binds pre-mRNA and nucleates the assembly of 40S hnRNP particles. Interacts with poly-U tracts in the 3' UTR or 5'-UTR of mRNA and modulates the stability and the level of translation of bound mRNA molecules. Single HNRNPC tetramers bind 230-240 nucleotides. Trimers of HNRNPC tetramers bind 700 nucleotides. May play a role in the early steps of spliceosome assembly and pre-mRNA splicing. N6-methyladenosine (m6A) has been shown to alter the local structure in mRNAs and long non-coding RNAs (lncRNAs) via a mechanism named 'm(6)A-switch', facilitating binding of HNRNPC, leading to regulation of mRNA splicing.[UniProtKB/Swiss-Prot Function]