Aktip (NM_010241) Mouse Recombinant Protein

CAT#: TP504014

Purified recombinant protein of Mouse thymoma viral proto-oncogene 1 interacting protein (Aktip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204014 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNPLWSMSAGSVRKRAEGEEKTLAGDVKTSPPRSAPKKQLPSIPKNALPIAKPTSPAPAAQSTNGTHASY
  GPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALVWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRL
  LFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTTSPLNPEAAVLYEKDIQLFK
  SKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPDEQHNKSVHVAGLSWVKPGSV
  QPFSKEEKTVAT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 32.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034371
• Locus ID: 14339
• UniProt ID: Q64362
• Cytogenetics: 8 44.25 cM
• Refseq Size: 2173
• Refseq ORF: 879
• Synonyms: AL023020; Fif; Ft; Ft1; Fts
• Summary: Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). Regulates apoptosis by enhancing phosphorylation and activation of AKT1. Increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade (By similarity).[UniProtKB/Swiss-Prot Function]