Aktip (NM_010241) Mouse Recombinant Protein
CAT#: TP504014
Purified recombinant protein of Mouse thymoma viral proto-oncogene 1 interacting protein (Aktip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Aktip"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204014 protein sequence
Red=Cloning site Green=Tags(s) MNPLWSMSAGSVRKRAEGEEKTLAGDVKTSPPRSAPKKQLPSIPKNALPIAKPTSPAPAAQSTNGTHASY GPFYLEYSLLAEFTLVVKQKLPGVYVQPSYRSALVWFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRL LFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTTSPLNPEAAVLYEKDIQLFK SKVVDSVKVCTARLFDQPKIEDPYAISFSPWNPSVHDEAREKMLTQKKPDEQHNKSVHVAGLSWVKPGSV QPFSKEEKTVAT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 32.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034371 |
Locus ID | 14339 |
UniProt ID | Q64362 |
Cytogenetics | 8 44.25 cM |
Refseq Size | 2173 |
Refseq ORF | 879 |
Synonyms | AL023020; Fif; Ft; Ft1; Fts |
Summary | Component of the FTS/Hook/FHIP complex (FHF complex). The FHF complex may function to promote vesicle trafficking and/or fusion via the homotypic vesicular protein sorting complex (the HOPS complex). Regulates apoptosis by enhancing phosphorylation and activation of AKT1. Increases release of TNFSF6 via the AKT1/GSK3B/NFATC1 signaling cascade (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.