6720467C03Rik (BC020162) Mouse Recombinant Protein

CAT#: TP503897

Purified recombinant protein of Mouse RIKEN cDNA 6720467C03 gene (cDNA clone MGC:28237 IMAGE:3991990), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203897 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRRNLDERDAQTKQLQDAVTNVEKHFGELCQIFAAYVRKTARLRDKADLLVNEINLYASTETPNLKQGL
  KDFADEFAKLQDYRQAEVERLEAKVVEPLKAYGTIVKMKRDDLKATLTARNREAKQLSQLERTRQRNPSD
  RHVISQAETELQRATIDATRTSRHLEETIDNFEKQKIKDIKNILSEFITIEMLFHGKALEVFTAAYQNIQ
  KIDEDEDLEVFRNSLYLSDYPSRLDIVRANSKSPLQRSLSTKCTSGTGQISTCRTRKDQQVEDEDDEELD
  VTEDEN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 33.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 68099
• UniProt ID: Q8BP22
• Cytogenetics: 4 A1
• Refseq Size: 1112
• Refseq ORF: 858
• Synonyms: 6720467C03Rik; Fam92a1
• Summary: Probable regulator of ciliogenesis involved in limb morphogenesis (PubMed:30395363). In cooperation with CBY1 it is involved in the recruitment and fusion of endosomal vesicles at distal appendages during early stages of ciliogenesis (By similarity).[UniProtKB/Swiss-Prot Function]