Spin1 (NM_146043) Mouse Recombinant Protein

CAT#: TP503454

Purified recombinant protein of Mouse spindlin 1 (Spin1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203454 representing NM_146043
  Red=Cloning site Green=Tags(s)
  
  MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVT
  QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM
  FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV
  DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 30.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666155
• Locus ID: 20729
• UniProt ID: Q61142
• Cytogenetics: 13 26.04 cM
• Refseq Size: 1064
• Refseq ORF: 786
• Synonyms: Spin
• Summary: Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (By similarity). Overexpression induces metaphase arrest and chromosomal instability (PubMed:18543248). Localizes to active rDNA loci and promotes the expression of rRNA genes. May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption (PubMed:23894536).[UniProtKB/Swiss-Prot Function]