Irak1bp1 (NM_022986) Mouse Recombinant Protein

CAT#: TP503348

Purified recombinant protein of Mouse interleukin-1 receptor-associated kinase 1 binding protein 1 (Irak1bp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203348 representing NM_022986
  Red=Cloning site Green=Tags(s)
  
  MSLQPAPASRVFMELVPWADRGRENHPISAAEAQPIGRRPHVAEAHPGAREVHVSGAAEVSASPDRALVT
  VRVSSTKEVSAEAKKSVCRRLDYITQSLQQQGFQAENVTVTKNIRRVENAYHMEAEVCITFTEFGKMQNI
  CNFLVEKLDSSVVISPPEFYHTPGSVENLRRQACLVAVENAWRKAQEVCDLVGQTLGKPLLIKEEETKDW
  EGQTDDHQLSRLPGTLTVQQKIKSATIHAASKVFITFEVKGKEKKKKHL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 29.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_075362
• Locus ID: 65099
• UniProt ID: Q9ESJ7
• Cytogenetics: 9 E2
• Refseq Size: 1893
• Refseq ORF: 777
• Synonyms: 4921528N06Rik; Aabp3; AI851240; Aip70; Simpl
• Summary: Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity.[UniProtKB/Swiss-Prot Function]