Bcap31 (NM_012060) Mouse Recombinant Protein

CAT#: TP503066

Purified recombinant protein of Mouse B cell receptor associated protein 31 (Bcap31), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR203066 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREI
  LKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA
  ESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALA
  MQKQSEGLTKEYDRLLEEHAKLQASVRGPSVKKEE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 28 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036190
• Locus ID: 27061
• UniProt ID: Q61335
• Cytogenetics: X A7.3
• Refseq Size: 1214
• Refseq ORF: 738
• Synonyms: Bap31
• Summary: Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.[UniProtKB/Swiss-Prot Function]