Bcap31 (NM_012060) Mouse Recombinant Protein
CAT#: TP503066
Purified recombinant protein of Mouse B cell receptor associated protein 31 (Bcap31), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Bcap31"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203066 protein sequence
Red=Cloning site Green=Tags(s) MSLQWTTVATFLYAEVFAVLLLCIPFISPKRWQKVFKSRLVELVVTYGNTFFVVLIVILVLLVIDAVREI LKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQA ESASEAAKKYMEENDQLKKGAAEDGDKLDIGNTEMKLEENKSLKNDLRKLKDELASTKKKLEKAENEALA MQKQSEGLTKEYDRLLEEHAKLQASVRGPSVKKEE myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036190 |
Locus ID | 27061 |
UniProt ID | Q61335 |
Cytogenetics | X A7.3 |
Refseq Size | 1214 |
Refseq ORF | 738 |
Synonyms | Bap31 |
Summary | Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.