Nqo2 (NM_001163242) Mouse Recombinant Protein

CAT#: TP502793

Purified recombinant protein of Mouse N-ribosyldihydronicotinamide quinone reductase 2 (Nqo2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202793 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGKKVLIVYAHQEPKSFNGSLKKVAVEELSKQGCTVTVSDLYSMNFEPRATRNDITGAPSNPDVFSYGI
  ETHEAYKKKALTSDIFEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCRGFAFDIPGFYDSGFLKG
  KLALLSLTTGGTAEMYTKDGVSGDFRYFLWPLQHGTLHFCGFKVLAPQISFGLDVSSEEERKVMLASWAQ
  RLKSIWKEEPIHCTPPWYFQE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001156714
• Locus ID: 18105
• UniProt ID: Q9JI75
• Cytogenetics: 13 14.01 cM
• Refseq Size: 3821
• Refseq ORF: 696
• Synonyms: NMO2; Nmor2; Ox2
• Summary: The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinones involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.[UniProtKB/Swiss-Prot Function]