Gins4 (NM_024240) Mouse Recombinant Protein

CAT#: TP502583

Purified recombinant protein of Mouse GINS complex subunit 4 (Sld5 homolog) (Gins4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202583 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTEVLDLHGQDSDGGSEEMVLTPAELIEKLEQAWMNEKFAPELLESKAEIVECVMEQLEHMEENLRRAKK
  GDLKVSIHRMEMERIRYVLSSYLRCRLMKIEKFFPHILEKEKVRSEGEPSSLSPEEFVFAKEYMDHTETH
  FKNVALKHMPPNLQKVDLLRAVPKPDLDSYVFLRVKERQENILVEPEADEQRDYVIDLEVGSQHLIRYKT
  IAPLVASGAVQLI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_077202
• Locus ID: 109145
• UniProt ID: Q99LZ3
• Cytogenetics: 8 A2
• Refseq Size: 1364
• Refseq ORF: 672
• Synonyms: 2810037C03Rik; 4933405K01Rik; Sld5
• Summary: The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA (By similarity).[UniProtKB/Swiss-Prot Function]