Caln1 (NM_021371) Mouse Recombinant Protein

CAT#: TP502484

Purified recombinant protein of Mouse calneuron 1 (Caln1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR202484 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPFHHVTAGLLYKGNYLNRSLSAGSDSEQLANISVEELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY
  MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVSSEGRDGFLGNTIDSIFWQFDMQRVTLEELKHIL
  YHAFRDHLTMKDIENIIINEEESLNETSGNCQTEFEGVHSQKQNRQTCVRKSLICAFAMAFIISVMLIAA
  NQILRSGME
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 24.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067346
• Locus ID: 140904
• UniProt ID: Q9JJG7, Q542R1, F8WHE1
• Cytogenetics: 5 G1.3- G2
• Refseq Size: 2586
• Refseq ORF: 660
• Synonyms: 9630012C17Rik; Cabp8; MNCb-0849
• Summary: Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity (By similarity). May play a role in the physiology of neurons and is potentially important in memory and learning.[UniProtKB/Swiss-Prot Function]